PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00521.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 382aa    MW: 43111.4 Da    PI: 6.5045
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00521.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093083422155
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              k +yps++++  LA+++gL+++q+ +WF N+R ++
  Rsa1.0_00521.1_g00007.1 308 KWPYPSEQQKLALAESTGLDQKQINNWFINQRKRH 342
                              569*****************************885 PP

2ELK413.9e-14262283122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELK qLlrKYsgyLgsLkqEF+
  Rsa1.0_00521.1_g00007.1 262 ELKGQLLRKYSGYLGSLKQEFM 283
                              9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.9E-19119163IPR005540KNOX1
PfamPF037903.3E-20121159IPR005540KNOX1
SMARTSM012567.0E-26170221IPR005541KNOX2
PfamPF037911.8E-20174219IPR005541KNOX2
SMARTSM011882.8E-8262283IPR005539ELK domain
PROSITE profilePS5121311.174262282IPR005539ELK domain
PfamPF037896.4E-11262283IPR005539ELK domain
PROSITE profilePS5007113.151282345IPR001356Homeobox domain
SMARTSM003895.3E-13284349IPR001356Homeobox domain
SuperFamilySSF466891.45E-19284360IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-28287347IPR009057Homeodomain-like
CDDcd000861.71E-12294346No hitNo description
PfamPF059203.4E-17302341IPR008422Homeobox KN domain
PROSITE patternPS000270320343IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MESGSNSTSC PMAFAGDNSD GPMCPMMMMM MPIITSHQQH HGHDQQHQHQ QQHDGYAYQS  60
HHQQSNSLFL QSLTPPSQEA KNNVTSSCSP SSGAPAYSFM EINHQNELLT GGLNPCSSAS  120
VKAKIMAHPH YHRLLLAYVN CQKVGAPPEV QTRLEETCSS AAAAAASMGP TGSLGEDPGL  180
DQFMEAYCEM LVKYEQELSK PFKEAMVFLQ HVECQFKSLS LSSPSSFSGY GEAAIERNNN  240
GSSEEEVDMN NEFVDPQAED RELKGQLLRK YSGYLGSLKQ EFMKKRKKGK LPKEARQQLL  300
DWWSRHYKWP YPSEQQKLAL AESTGLDQKQ INNWFINQRK RHWKPSEDMQ FVVMDATHPH  360
HYFMDNVMGN PFPIDHISST ML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277286LKQEFMKKRK
2283287KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU4805850.0GU480585.1 Brassica rapa SHOOT MERISTEMLESS (STM) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302988.10.0homeobox protein SHOOT MERISTEMLESS
SwissprotQ9M6D90.0STM_BRAOL; Homeobox protein SHOOT MERISTEMLESS
TrEMBLM4EE390.0M4EE39_BRARP; Uncharacterized protein
STRINGBra027050.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64732644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.10.0KNOX/ELK homeobox transcription factor